{"product_id":"proteintech-10702-1-ap","title":"Proteintech, 10702-1-AP, VAMP3\/Cellubrevin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAMP3\/Cellubrevin (10702-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP3\/Cellubrevin in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10702-1-AP targets VAMP3\/Cellubrevin in WB, IHC, IF, IP, ELISA, Blocking applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  mouse brain tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAMP3, also named as cellubrevin or synaptobrevin 3, is a member of the vesicle-associated membrane protein (VAMP)\/synaptobrevin family. VAMP3 is a v-SNARE (soluble NSF-attachment protein receptor). Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP3 resides in recycling endosomes and endosome-derived transport vesicles, involved in regulating membrane traffic. It is implicated in recycling of transferrin receptors, secretion of alpha-granules in platelets, and membrane trafficking during cell migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1156 Product name: Recombinant human VAMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC005941 Sequence: MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCEMWAIGITVLVIFIIIIIVWVVS Predict reactive species\nFull Name: vesicle-associated membrane protein 3 (cellubrevin)\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11-17 kDa\nGenBank Accession Number: BC005941\nGene Symbol: VAMP3\nGene ID (NCBI): 9341\nRRID: AB_2212628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15836\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877803689,"sku":"10702-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10702-1-ap","provider":"Iright","version":"1.0","type":"link"}