{"product_id":"proteintech-10740-1-ap","title":"Proteintech, 10740-1-AP, RTN4\/NOGO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RTN4\/NOGO (10740-1-AP) by Proteintech is a Polyclonal antibody targeting RTN4\/NOGO in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10740-1-AP targets RTN4\/NOGO in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse testis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. RTN4 (also known as Neurite outgrowth inhibitor or Nogo) is a myelin-associated neurite growth inhibitory protein. Some isoforms of RTN4 have been described. RTN4A (Nogo-A, runs at ~200 kDa), RTN4B (Nogo-B, 40-55 kDa), and RTN4C (Nogo-C, 22-25 kDa) are three major isoforms (PMID: 31092426; 16469703).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1164 Product name: Recombinant human RTN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC007109 Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE Predict reactive species\nFull Name: reticulon 4\nCalculated Molecular Weight: 130 kDa\nObserved Molecular Weight: 190-210 kDa, 45 kDa, 22-25 kDa\nGenBank Accession Number: BC007109\nGene Symbol: NOGO\nGene ID (NCBI): 57142\nRRID: AB_2183598\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882915497,"sku":"10740-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10740-1-ap","provider":"Iright","version":"1.0","type":"link"}