{"product_id":"proteintech-10749-1-ap","title":"Proteintech, 10749-1-AP, RHOA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOA (10749-1-AP) by Proteintech is a Polyclonal antibody targeting RHOA in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10749-1-AP targets RHOA in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  rat brain tissue,  PC-12 cells,  HL-60 cells,  mouse brain tissue,  HUVEC cells,  NIH\/3T3 cells,  fetal human brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhat is the function of RhoA?Ras homolog gene family, member A (RhoA) is a small GTPase that is involved in cytoskeleton organization.1It is important in actomyosin contractility, as when RhoA binds to GTP it initiates a cascade of events mediating stress fiber or contractile ring formation, where actin bundles crosslink with other proteins. It is also associated with actin polymerization, making RhoA important in membrane ruffling and cell motility.2The role of RhoA is essential in cell migration and adhesion.What is the cellular localization of RhoA?In motile cells, a leading edge stretches ahead, stabilizes, the cytoskeleton is reorganized, and the tail of the cell retracts. The role of RhoA in contracting actomyosin has linked RhoA with the tail retraction in this process, but studies into the spatiotemporal kinetics of GTPases have revealed that RhoA is also located at the leading edge of migrating cells.3This highlights the dual roles of this protein in actin contractility and polymerization.What is the role of RhoA in disease?Though it is not an oncogene, the role of RhoA in adhesion and migration has implicated this protein in cancer biology. Expression of RhoA has been found to be higher in malignant tumors compared to benign tumors or in non-tumor tissue, and more invasive tumors have been found to overexpress RhoA.4This protein is also implicated in neurodegenerative diseases and aging due to its role in axon guidance, with abnormal localization of RhoA associated with Alzheimer's and Parkinson's pathology.5,61.Ridley, A. J. \u0026amp; Hall, A. The small GTP-binding protein rho regulates the assembly of focal adhesions and actin stress fibers in response to growth factors.Cell70,389-399 (1992).2.21.   Kurokawa, K. \u0026amp; Matsuda, M. Localized RhoA Activation as a Requirement for the Induction of Membrane Ruffling.Mol. Biol. Cell16,4294-4303 (2005).3.22.   Struckhoff, A. P., Rana, M. K. \u0026amp; Worthylake, R. A. RhoA can lead the way in tumor cell invasion and metastasis.Front. Biosci. (Landmark Ed.16,1915-26 (2011).4.23.   Mcglasson, S.et al.Rare variants of the 3'-5' DNA exonuclease in early onset TREX1 small vessel stroke [version 1; referees: awaiting peer review]. doi:10.12688\/wellcomeopenres.12631.15.24.   Huesa, G.et al.Altered Distribution of RhoA in Alzheimer's Disease and AβPP Overexpressing Mice.J. Alzheimer's Dis.19,37-56 (2010).6.25.   Hynds, D. L. Subcellular localization of Rho GTPases: implications for axon regeneration.Neural Regen. Res.10,1032-3 (2015).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1141 Product name: Recombinant human RHOA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC005976 Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL Predict reactive species\nFull Name: ras homolog gene family, member A\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC005976\nGene Symbol: RHOA\nGene ID (NCBI): 387\nRRID: AB_2285104\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868824424617,"sku":"10749-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10749-1-ap","provider":"Iright","version":"1.0","type":"link"}