{"product_id":"proteintech-10774-1-ap","title":"Proteintech, 10774-1-AP, SFTPC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFTPC (10774-1-AP) by Proteintech is a Polyclonal antibody targeting SFTPC in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n10774-1-AP targets SFTPC in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFTPC (surfactant protein C), also named as SFTP2, SP5 and SP-C, is a pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Defects in SFTPC are the cause of pulmonary surfactant metabolism dysfunction type 2 (SMDP2). Genetic variations in SFTPC are associated with respiratory distress syndrome in premature infants (RDS). Two isoforms of the human protein are produced by alternative splicing. One previous study reported that SFTPC deletion was observed in NSCLC tissues, implying that SFTPC downregulation might be involved in the progression of lung cancer. (PMID: 35081981, PMID: 31379200)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1159 Product name: Recombinant human SFTPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC005913 Sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI Predict reactive species\nFull Name: surfactant protein C\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC005913\nGene Symbol: SFTPC\nGene ID (NCBI): 6440\nRRID: AB_2185497\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11686\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868834615465,"sku":"10774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10774-1-ap","provider":"Iright","version":"1.0","type":"link"}