{"product_id":"proteintech-10779-1-ap","title":"Proteintech, 10779-1-AP, TCEB2\/Elongin-B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCEB2\/Elongin-B (10779-1-AP) by Proteintech is a Polyclonal antibody targeting TCEB2\/Elongin-B in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n10779-1-AP targets TCEB2\/Elongin-B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, mouse skeletal muscle tissue,  HEK-293 cells,  HeLa cells,  K-562 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex and is also reported to function as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes (PMID: 26531153). TCEB2 has 2 isoforms with the molecular mass of 13 and 18 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1228 Product name: Recombinant human TCEB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC013306 Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ Predict reactive species\nFull Name: transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC013306\nGene Symbol: TCEB2\nGene ID (NCBI): 6923\nRRID: AB_2240375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15370\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990230697,"sku":"10779-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10779-1-ap","provider":"Iright","version":"1.0","type":"link"}