{"product_id":"proteintech-10787-1-ap","title":"Proteintech, 10787-1-AP, Prohibitin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Prohibitin (10787-1-AP) by Proteintech is a Polyclonal antibody targeting Prohibitin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10787-1-AP targets Prohibitin in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human liver tissue,  human brain tissue,  NIH\/3T3 cells,  HeLa cells,  Raji cells,  Jurkat cells,  mouse brain tissue,  mouse heart tissue,  mouse kidney tissue,  rat brain tissue,  rat heart tissue,  rat kidney tissue\nPositive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProhibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species\nFull Name: prohibitin\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013401\nGene Symbol: Prohibitin\nGene ID (NCBI): 5245\nRRID: AB_2164476\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35232\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868863320233,"sku":"10787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10787-1-ap","provider":"Iright","version":"1.0","type":"link"}