{"product_id":"proteintech-10815-1-ap","title":"Proteintech, 10815-1-AP, Kallikrein 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kallikrein 1 (10815-1-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 1 in WB, IP, IHC, ELISA applications with reactivity to human samples\n10815-1-AP targets Kallikrein 1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells,  BxPC-3 cells\nPositive IP detected in: BxPC-3 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK1 (tissue kallikrein 1) is a member of the tissue kallikrein family of serine proteases and is the primary kinin-generating enzyme in human airways. It is involved in the control of ionic transport in the renal tubule, an action that may not be kinin-mediated. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1119 Product name: Recombinant human KLK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC005313 Sequence: MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS Predict reactive species\nFull Name: kallikrein 1\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC005313\nGene Symbol: KLK1\nGene ID (NCBI): 3816\nRRID: AB_2131019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06870\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869413527721,"sku":"10815-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10815-1-ap","provider":"Iright","version":"1.0","type":"link"}