{"product_id":"proteintech-10847-1-ap","title":"Proteintech, 10847-1-AP, MST4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MST4 (10847-1-AP) by Proteintech is a Polyclonal antibody targeting MST4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10847-1-AP targets MST4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  HL-60 cells,  MCF-7 cells,  L02 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1302 Product name: Recombinant human MST4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC017213 Sequence: MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP Predict reactive species\nFull Name: serine\/threonine protein kinase MST4\nCalculated Molecular Weight: 16 kDa, 46 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC017213\nGene Symbol: MST4\nGene ID (NCBI): 51765\nRRID: AB_513907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943012009,"sku":"10847-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10847-1-ap","provider":"Iright","version":"1.0","type":"link"}