{"product_id":"proteintech-10873-1-ap","title":"Proteintech, 10873-1-AP, PITX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PITX1 (10873-1-AP) by Proteintech is a Polyclonal antibody targeting PITX1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n10873-1-AP targets PITX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human tonsillitis tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPITX1, also named as Pituitary homeobox 1 or BFT, is a 314 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the paired homeobox family. Bicoid subfamily. PITX1 localizes in the nucleus and may play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1303 Product name: Recombinant human PITX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC009412 Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS Predict reactive species\nFull Name: paired-like homeodomain 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC009412\nGene Symbol: PITX1\nGene ID (NCBI): 5307\nRRID: AB_10859664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78337\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971782313,"sku":"10873-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10873-1-ap","provider":"Iright","version":"1.0","type":"link"}