{"product_id":"proteintech-10880-1-ap","title":"Proteintech, 10880-1-AP, GAMT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAMT (10880-1-AP) by Proteintech is a Polyclonal antibody targeting GAMT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10880-1-AP targets GAMT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue,  rat liver tissue,  HepG2 cells,  SH-SY5Y cells\nPositive IHC detected in: human liver tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAMT converts the latter to creatine with S-adenosylmethionine as the methyl donor. GAMT was induced in human and mouse cells in response to genotoxic and metabolic stress. GAMT was required for p53-dependent upregulation of creatine biosynthesis, fatty acid oxidation, and apoptosis in response to glucose deprivation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1327 Product name: Recombinant human GAMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC016760 Sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG Predict reactive species\nFull Name: guanidinoacetate N-methyltransferase\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC016760\nGene Symbol: GAMT\nGene ID (NCBI): 2593\nRRID: AB_2109304\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14353\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924760233,"sku":"10880-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10880-1-ap","provider":"Iright","version":"1.0","type":"link"}