{"product_id":"proteintech-10892-2-ap","title":"Proteintech, 10892-2-AP, CSRP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSRP2 (10892-2-AP) by Proteintech is a Polyclonal antibody targeting CSRP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10892-2-AP targets CSRP2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse kidney tissue,  rat kidney tissue,  L02 cells,  U-251 cells,  U-87 MG cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSRP2 (Cysteine and glycine-rich protein 2) is a member of the LIM-only family of cysteine-rich proteins and contains two LIM domains, which has been recently implicated in the progression and metastasis of a variety of cancers. CSRP2 is functionally linked to the activity of TGF-b1 in\nhepatic stellate cells (HSC), derivatives thereof, and in differentiated VSMC.CSRP2 knockdown signifcantly inhibits hypoxia-stimulated invadopodium formation, ECM degradation and invasion in MDA-MB-231 cells (PMID: 33042270). CSRP2 is a short (21 kDa) two LIM domain-containing protein, which is upregulated in invasive breast cancer cells, and localizes along the protrusive actin core of invadopodium1 (PMID: 29976963, 16735029).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1338 Product name: Recombinant human CSRP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC000992 Sequence: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ Predict reactive species\nFull Name: cysteine and glycine-rich protein 2\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC000992\nGene Symbol: CSRP2\nGene ID (NCBI): 1466\nRRID: AB_2087738\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940030121,"sku":"10892-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10892-2-ap","provider":"Iright","version":"1.0","type":"link"}