{"product_id":"proteintech-10901-1-ap","title":"Proteintech, 10901-1-AP, VPS18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS18 (10901-1-AP) by Proteintech is a Polyclonal antibody targeting VPS18 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10901-1-AP targets VPS18 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissue, human testis tissue,  mouse brain tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking\/fusion reactions of late endosomes\/lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1140 Product name: Recombinant human VPS18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species\nFull Name: vacuolar protein sorting 18 homolog (S. cerevisiae)\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC001513\nGene Symbol: VPS18\nGene ID (NCBI): 57617\nRRID: AB_2273089\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P253\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961984681,"sku":"10901-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10901-1-ap","provider":"Iright","version":"1.0","type":"link"}