{"product_id":"proteintech-10905-1-ap","title":"Proteintech, 10905-1-AP, ING3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ING3 (10905-1-AP) by Proteintech is a Polyclonal antibody targeting ING3 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n10905-1-AP targets ING3 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse uterus tissue,  HepG2 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMembers of inhibitor of growth (ING) family function in inhibiting cell growth and inducing apoptosis. They are sequence homologous proteins. ING3 can activate p53 trans-activated promoters, including promoters of p21\/waf1 and bax. This antibody is specifically against p47ING3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1357 Product name: Recombinant human ING3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC009777 Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF Predict reactive species\nFull Name: inhibitor of growth family, member 3\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC009777\nGene Symbol: ING3\nGene ID (NCBI): 54556\nRRID: AB_2127780\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NXR8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868968472745,"sku":"10905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10905-1-ap","provider":"Iright","version":"1.0","type":"link"}