{"product_id":"proteintech-10916-1-ap","title":"Proteintech, 10916-1-AP, SRp20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRp20 (10916-1-AP) by Proteintech is a Polyclonal antibody targeting SRp20 in IHC, ELISA applications with reactivity to human, mouse samples\n10916-1-AP targets SRp20 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human cervical cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS3, also named as SRSF3 and SRP20, belongs to the splicing factor SR family. It may be involved in RNA processing in relation with cellular proliferation and\/or maturation. SFRS3 is one of the cognate factors. It is a proto-oncogene critical for cell proliferation and tumor induction and maintenance.The MW of SFRS3 is 20kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1341 Product name: Recombinant human SRp20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC000914 Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 3\nCalculated Molecular Weight: 20 kDa\nGenBank Accession Number: BC000914\nGene Symbol: SRSF3\nGene ID (NCBI): 6428\nRRID: AB_2185064\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P84103\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989903017,"sku":"10916-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10916-1-ap","provider":"Iright","version":"1.0","type":"link"}