{"product_id":"proteintech-10936-1-ap","title":"Proteintech, 10936-1-AP, YWHAB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YWHAB (10936-1-AP) by Proteintech is a Polyclonal antibody targeting YWHAB in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10936-1-AP targets YWHAB in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine\/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1383 Product name: Recombinant human YWHAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010352 Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT Predict reactive species\nFull Name: tyrosine 3-monooxygenase\/tryptophan 5-monooxygenase activation protein, beta polypeptide\nCalculated Molecular Weight: 28 kDa\nGenBank Accession Number: BC010352\nGene Symbol: YWHAB\nGene ID (NCBI): 7529\nRRID: AB_2217489\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31946\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793964201,"sku":"10936-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10936-1-ap","provider":"Iright","version":"1.0","type":"link"}