{"product_id":"proteintech-10952-1-ap","title":"Proteintech, 10952-1-AP, CTDSP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTDSP1 (10952-1-AP) by Proteintech is a Polyclonal antibody targeting CTDSP1 in WB, ELISA applications with reactivity to human, mouse samples\n10952-1-AP targets CTDSP1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse kidney tissue,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTDSP1 also named as NIF3, NLIIF, or SCP1, is a 261 amino acid protein, which contains one FCP1 homology domain. CTDSP1 localizes in the nucleus and colocalizes with RNA polymerase II. CTDSP1 is expressed in non-neuronal tissues. It is highly expressed in skeletal muscle, spleen, lung and placenta. CTDSP1 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1410 Product name: Recombinant human CTDSP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC012977 Sequence: MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS Predict reactive species\nFull Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 29-33 kDa\nGenBank Accession Number: BC012977\nGene Symbol: CTDSP1\nGene ID (NCBI): 58190\nRRID: AB_2087073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZU7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869401829545,"sku":"10952-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10952-1-ap","provider":"Iright","version":"1.0","type":"link"}