{"product_id":"proteintech-10960-1-ap","title":"Proteintech, 10960-1-AP, Cofilin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cofilin (10960-1-AP) by Proteintech is a Polyclonal antibody targeting Cofilin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10960-1-AP targets Cofilin in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NIH\/3T3 cells,  human skin tissue,  human brain tissue,  mouse brain tissue,  rat brain tissue,  NCI-H1299 cells\nPositive IHC detected in: human colon tissue, human cervical cancer tissue,  human heart tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)\/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1399 Product name: Recombinant human Cofilin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species\nFull Name: cofilin 1 (non-muscle)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC012318\nGene Symbol: Cofilin\nGene ID (NCBI): 1072\nRRID: AB_2291830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23528\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868854931625,"sku":"10960-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10960-1-ap","provider":"Iright","version":"1.0","type":"link"}