{"product_id":"proteintech-10961-1-ap","title":"Proteintech, 10961-1-AP, ARL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL3 (10961-1-AP) by Proteintech is a Polyclonal antibody targeting ARL3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, canine samples\n10961-1-AP targets ARL3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, PC-3 cells,  human brain tissue,  mouse testis tissue,  rat brain tissue,  HeLa cells,  rat testis tissue\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MDCK cells, IMCD3 cells,  hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARL3 (ADP-ribosylation factor-like 3) is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. ARL3 is believed to be involved in ciliary and microtubule-dependent processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1406 Product name: Recombinant human ARL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC009841 Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK Predict reactive species\nFull Name: ADP-ribosylation factor-like 3\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa, 25 kDa\nGenBank Accession Number: BC009841\nGene Symbol: ARL3\nGene ID (NCBI): 403\nRRID: AB_2274220\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875542697,"sku":"10961-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10961-1-ap","provider":"Iright","version":"1.0","type":"link"}