{"product_id":"proteintech-10990-2-ap","title":"Proteintech, 10990-2-AP, SKP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SKP1 (10990-2-AP) by Proteintech is a Polyclonal antibody targeting SKP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10990-2-AP targets SKP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  MCF-7 cells,  mouse brain tissue,  mouse testis tissue\nPositive IHC detected in: human gliomas tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSKP1(S-phase kinase-associated protein 1) is also named as EMC19, OCP2, SKP1A, TCEB1L,belongs to the SKP1 family.It is an essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1457 Product name: Recombinant human SKP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC009839 Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK Predict reactive species\nFull Name: S-phase kinase-associated protein 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC009839\nGene Symbol: SKP1\nGene ID (NCBI): 6500\nRRID: AB_2187492\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63208\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921057449,"sku":"10990-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10990-2-ap","provider":"Iright","version":"1.0","type":"link"}