{"product_id":"proteintech-10997-2-ap","title":"Proteintech, 10997-2-AP, POLG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLG2 (10997-2-AP) by Proteintech is a Polyclonal antibody targeting POLG2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10997-2-AP targets POLG2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, mouse colon tissue,  HeLa cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nmtDNA is replicated by DNA polymerase gamma, which is composed of a catalytic (encoded\nby POLG) and an accessory subunit (encoded by POLG2). POLG2(DNA polymerase subunit gamma-2, mitochondrial) can stimulate the polymerase and exonuclease activities (PMID: 37085601). Defects in POLG2 are the cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 4 (PEOA4) (PMID: 16685652).Western blot result suggested that the POLG2 expressed in human fetal kidney and U-251 MG cell lines with a single band of 55kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1424 Product name: Recombinant human POLG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-485 aa of BC009194 Sequence: GPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPAYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV Predict reactive species\nFull Name: polymerase (DNA directed), gamma 2, accessory subunit\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC009194\nGene Symbol: POLG2\nGene ID (NCBI): 11232\nRRID: AB_2299887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHN1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868971978921,"sku":"10997-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10997-2-ap","provider":"Iright","version":"1.0","type":"link"}