{"product_id":"proteintech-11002-1-ap","title":"Proteintech, 11002-1-AP, MIPEP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIPEP (11002-1-AP) by Proteintech is a Polyclonal antibody targeting MIPEP in WB, IHC, ELISA applications with reactivity to human samples\n11002-1-AP targets MIPEP in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIPEP(Mitochondrial intermediate peptidase) is also named as MIP and belongs to the peptidase M3 family. It performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. The enzyme is a monomer of 75 kDa with a transit peptide and about 20% of the fmal MIP preparation consists of equimolar amounts of two peptides of 47 kDa and 28 kDa, which are apparently the products of a single cleavage of the 75 kDa protein. MIP is an independent endopeptidase acting on mitochondrial intermediate proteins as substrates.(PMID:1322290).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1451 Product name: Recombinant human MIPEP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-357 aa of BC009934 Sequence: MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTELLVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLQKLLADKKLVDSLDPETRRVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWD Predict reactive species\nFull Name: mitochondrial intermediate peptidase\nCalculated Molecular Weight: 81 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC009934\nGene Symbol: MIPEP\nGene ID (NCBI): 4285\nRRID: AB_2235137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559607465,"sku":"11002-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11002-1-ap","provider":"Iright","version":"1.0","type":"link"}