{"product_id":"proteintech-11006-1-ap","title":"Proteintech, 11006-1-AP, PPAN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPAN (11006-1-AP) by Proteintech is a Polyclonal antibody targeting PPAN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11006-1-AP targets PPAN in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  rat heart tissue,  rat liver tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPAN (or SSF, SSF1 or SSF2) gene is widely expressed, and encodes peter pan homolog protein which may be localized in nucleus. Two isoforms are produced through alternative splicing. So far the characterization of this protein is largely unknown, multiple phosphorylation sites has been revealed based on high-throughput phosphorylation analysis. This antibody is raised against the C-terminal of huaman PPAN and recognize bands around 55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, xenopus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1419 Product name: Recombinant human PPAN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-473 aa of BC009833 Sequence: LNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA Predict reactive species\nFull Name: peter pan homolog (Drosophila)\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 55-58 kDa\nGenBank Accession Number: BC009833\nGene Symbol: PPAN\nGene ID (NCBI): 56342\nRRID: AB_2168040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ55\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972044457,"sku":"11006-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11006-1-ap","provider":"Iright","version":"1.0","type":"link"}