{"product_id":"proteintech-11007-1-ap","title":"Proteintech, 11007-1-AP, CDK5RAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK5RAP3 (11007-1-AP) by Proteintech is a Polyclonal antibody targeting CDK5RAP3 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n11007-1-AP targets CDK5RAP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HEK-293T cells,  HeLa cells,  Jurkat cells\nPositive IHC detected in: human stomach tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin-dependent kinase 5 (CDK5) regulatory subunit associated protein 3 (CDK5RAP3, also named as C53 or LZAP) was initially identified as a binding protein of CDK5 activator p35. CDK5RAP3 is widely expressed in human tissues and broadly located in subcellular compartments. By interacting with other proteins, CDK5RAP3 participates in the regulation of multiple cellular processes including cell cycle, apoptosis, cell invasion, signaling transduction, autophagy, UFMylation and endoplasmic reticulum (ER) stress.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1474 Product name: Recombinant human CDK5RAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC009957 Sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES Predict reactive species\nFull Name: CDK5 regulatory subunit associated protein 3\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC009957\nGene Symbol: CDK5RAP3\nGene ID (NCBI): 80279\nRRID: AB_2076869\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868994261161,"sku":"11007-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11007-1-ap","provider":"Iright","version":"1.0","type":"link"}