{"product_id":"proteintech-11012-1-ap","title":"Proteintech, 11012-1-AP, EIF4H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF4H (11012-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4H in WB, ELISA applications with reactivity to human samples\n11012-1-AP targets EIF4H in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\neukaryotic initiation factor (eIF)4H, which encoded by the gene for HUMORFU_1, functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. And its homolog in human, WBSCR1, located on 7q11, is commonly missed in patients suffered the Williams-Beuren syndrome, which is a complex neurodevelopmental disorder characterized by cardiovascular defects, cerebral dysplasias and a peculiar cognitive-behavioral profile. EIF4H has two kind of isoforms. The short isoform(~25kDa) is the predominant isoform and is expressed alone in liver and skeletal muscle. This is a rabbit anti-EIF4H polyclonal antibody raised against part of N-terminal chain of human EIF4H, and can recognize two kinds of isoform.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1468 Product name: Recombinant human EIF4H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC010021 Sequence: MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQR Predict reactive species\nFull Name: eukaryotic translation initiation factor 4H\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC010021\nGene Symbol: EIF4H\nGene ID (NCBI): 7458\nRRID: AB_2096035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15056\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678391465,"sku":"11012-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11012-1-ap","provider":"Iright","version":"1.0","type":"link"}