{"product_id":"proteintech-11013-1-ap","title":"Proteintech, 11013-1-AP, SLC27A4\/FATP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC27A4\/FATP4 (11013-1-AP) by Proteintech is a Polyclonal antibody targeting SLC27A4\/FATP4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11013-1-AP targets SLC27A4\/FATP4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse liver tissue,  human colon tissue,  human heart tissue,  SMMC-7721 cells,  mouse colon tissue,  rat colon tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1490 Product name: Recombinant human SLC27A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC009959 Sequence: MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL Predict reactive species\nFull Name: solute carrier family 27 (fatty acid transporter), member 4\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC009959\nGene Symbol: FATP4\/SLC27A4\nGene ID (NCBI): 10999\nRRID: AB_2190637\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P1M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899332265,"sku":"11013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11013-1-ap","provider":"Iright","version":"1.0","type":"link"}