{"product_id":"proteintech-11015-2-ap","title":"Proteintech, 11015-2-AP, DOM3Z Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DOM3Z (11015-2-AP) by Proteintech is a Polyclonal antibody targeting DOM3Z in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11015-2-AP targets DOM3Z in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  SH-SY5Y cells\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDOM3Z also known as DXO, NG6, is a 396 amino acid ubiquitously expressed protein. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6  and  possesses RNA 5'-pyrophosphohydrolase activity. Chromosome 6 contains 170 million base pairs and represents nearly 6% of the human genome. Partial deletion of the q arm of chromosome 6 is associated with early-onset colorectal cancer. DOM3Z is ubiquitously expressed, with high expression in the testis (PMID: 9799600).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1491 Product name: Recombinant human DOM3Z protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-396 aa of BC009344 Sequence: MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK Predict reactive species\nFull Name: dom-3 homolog Z (C. elegans)\nCalculated Molecular Weight: 43.6 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC009344\nGene Symbol: DOM3Z\nGene ID (NCBI): 1797\nRRID: AB_2095257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O77932\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996784297,"sku":"11015-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11015-2-ap","provider":"Iright","version":"1.0","type":"link"}