{"product_id":"proteintech-11036-1-ap","title":"Proteintech, 11036-1-AP, Syntaxin 10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Syntaxin 10 (11036-1-AP) by Proteintech is a Polyclonal antibody targeting Syntaxin 10 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11036-1-AP targets Syntaxin 10 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  BxPC-3 cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyntaxin 10 (STX10), also named as SYN10, belongs to the syntaxin family. Syntaxins are target membrane SNAREs(Soluble NSF attachment protein receptors) which are membrane components that determine the specificity of the docking and fusion of vesicles to target membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1501 Product name: Recombinant human STX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC017237 Sequence: MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL Predict reactive species\nFull Name: syntaxin 10\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC017237\nGene Symbol: Syntaxin 10\nGene ID (NCBI): 8677\nRRID: AB_2198210\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60499\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869502656681,"sku":"11036-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11036-1-ap","provider":"Iright","version":"1.0","type":"link"}