{"product_id":"proteintech-11047-1-ap","title":"Proteintech, 11047-1-AP, UXT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UXT (11047-1-AP) by Proteintech is a Polyclonal antibody targeting UXT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n11047-1-AP targets UXT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitously expressed transcript (UXT) is a gene transcription regulator. It can regulate androgen receptor(AR) transcription by concerting with the coreperssor UR1. It is proposed a potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling, for UXT increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. UXT is possible a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. It can suppresses cell transformation and mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1513 Product name: Recombinant human UXT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC008890 Sequence: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH Predict reactive species\nFull Name: ubiquitously-expressed transcript\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 18 kDa, 45 kDa\nGenBank Accession Number: BC008890\nGene Symbol: UXT\nGene ID (NCBI): 8409\nRRID: AB_2241535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBK9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869626650793,"sku":"11047-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11047-1-ap","provider":"Iright","version":"1.0","type":"link"}