{"product_id":"proteintech-11062-1-ap","title":"Proteintech, 11062-1-AP, TIMM17B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIMM17B (11062-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM17B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11062-1-AP targets TIMM17B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse liver tissue,  PC-3 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1504 Product name: Recombinant human TIMM17B protein Source: e coli. -derived, PKG Tag: GST Domain: 1-172 aa of BC010142 Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 17 homolog B (yeast)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC010142\nGene Symbol: TIMM17B\nGene ID (NCBI): 10245\nRRID: AB_2201995\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937408681,"sku":"11062-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11062-1-ap","provider":"Iright","version":"1.0","type":"link"}