{"product_id":"proteintech-11078-1-ap","title":"Proteintech, 11078-1-AP, SLCO6A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLCO6A1 (11078-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO6A1 in WB, ELISA applications with reactivity to human, mouse samples\n11078-1-AP targets SLCO6A1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HEK-293T cells,  Jurkat cells,  K-562 cells,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLCO6A1, also named as OATP6A1 and SLC21A19, belongs to the organic anion transporter protein (OATPs) family. OATP proteins are reported to mediate the transport of a variety of low molecular weight substrates, such as drugs, toxins and steroid hormone conjugates. SLCO6A1 is strongly expressed in testis and weakly expressed in spleen, brain, fetal brain and placenta. SLCO6A1 has 3 isoforms with the molecular mass of 51, 73 and 79 kDa. (PMID: 26861727)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1532 Product name: Recombinant human SLCO6A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 570-657 aa of BC034976 Sequence: PSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLNENTDFPDVTVKNPKVKKKEETDL Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 6A1\nCalculated Molecular Weight: 719aa,79 kDa; 657aa,73 kDa\nObserved Molecular Weight: 73-80 kDa, 51 kDa\nGenBank Accession Number: BC034976\nGene Symbol: SLCO6A1\nGene ID (NCBI): 133482\nRRID: AB_2189858\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UG4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887808336041,"sku":"11078-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11078-1-ap","provider":"Iright","version":"1.0","type":"link"}