{"product_id":"proteintech-11147-2-ap","title":"Proteintech, 11147-2-AP, SEC61G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC61G (11147-2-AP) by Proteintech is a Polyclonal antibody targeting SEC61G in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11147-2-AP targets SEC61G in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: EC109 cells, HEK-293 cells,  DC2.4 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC61G is a subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. The SEC61 complex is the central component of the protein translocation apparatus on the endoplasmic reticulum membrane. The gene of SEC61G maps to chromosome 7p11.2, and encodes a 68-amino acid single-pass membrane protein. This antibody can recognize endogenous SEC61G that migrates at a molecular mass of ~8 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1624 Product name: Recombinant human SEC61G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC009480 Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG Predict reactive species\nFull Name: Sec61 gamma subunit\nCalculated Molecular Weight: 7.7 kDa\nObserved Molecular Weight: 7.7 kDa\nGenBank Accession Number: BC009480\nGene Symbol: SEC61G\nGene ID (NCBI): 23480\nRRID: AB_2254450\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60059\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877508777,"sku":"11147-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11147-2-ap","provider":"Iright","version":"1.0","type":"link"}