{"product_id":"proteintech-11173-1-ap","title":"Proteintech, 11173-1-AP, FKBP8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FKBP8 (11173-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP8 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11173-1-AP targets FKBP8 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue,  SH-SY5Y cells,  mouse brain tissue,  mouse pancreas tissue,  Jurkat cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase\/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1649 Product name: Recombinant human FKBP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC009966 Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN Predict reactive species\nFull Name: FK506 binding protein 8, 38kDa\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC009966\nGene Symbol: FKBP8\nGene ID (NCBI): 23770\nRRID: AB_10597097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980498601,"sku":"11173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11173-1-ap","provider":"Iright","version":"1.0","type":"link"}