{"product_id":"proteintech-11195-1-ap","title":"Proteintech, 11195-1-AP, SRP9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRP9 (11195-1-AP) by Proteintech is a Polyclonal antibody targeting SRP9 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11195-1-AP targets SRP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A2780 cells,  HeLa cells,  MCF-7 cells,  SKOV-3 cells,  mouse colon tissue,  HuH-7 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1683 Product name: Recombinant human SRP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species\nFull Name: signal recognition particle 9kDa\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC015094\nGene Symbol: SRP9\nGene ID (NCBI): 6726\nRRID: AB_2239820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49458\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904116393,"sku":"11195-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11195-1-ap","provider":"Iright","version":"1.0","type":"link"}