{"product_id":"proteintech-11203-1-ap","title":"Proteintech, 11203-1-AP, TXNL6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXNL6 (11203-1-AP) by Proteintech is a Polyclonal antibody targeting TXNL6 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n11203-1-AP targets TXNL6 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  HeLa cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXNL6, also named as NXNL1, belongs to the nucleoredoxin family. It may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.   TXNL6 is a Novel Oxidative Stress-Induced Reducing System for Methionine Sulfoxide Reductase A Repair of a-Crystallin and Cytochrome C in the Eye Lens. It serve as a reducing system for MsrA repair of the essential lens chaperone a-crystallin\/sHSP and mitochondrial cytochrome c. TXNL6 is induced at high levels in human lens epithelial cells exposed to H2O2-induced oxidative stress.(PMID:21079812)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1691 Product name: Recombinant human TXNL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC014127 Sequence: MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF Predict reactive species\nFull Name: nucleoredoxin-like 1\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 26-28 kDa\nGenBank Accession Number: BC014127\nGene Symbol: NXNL1\nGene ID (NCBI): 115861\nRRID: AB_2158126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CM4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869624586409,"sku":"11203-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11203-1-ap","provider":"Iright","version":"1.0","type":"link"}