{"product_id":"proteintech-11209-1-ap","title":"Proteintech, 11209-1-AP, Pancreatic Lipase Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pancreatic Lipase (11209-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic Lipase in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11209-1-AP targets Pancreatic Lipase in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, BxPC-3 cells,  human pancreas tissue,  rat pancreas tissue\nPositive IHC detected in: mouse pancreas tissue, human pancreas cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe pancreatic triacylglycerol lipase precursor (PNLIP), a 56 kDa protein secreted by the pancreas that is essential for the hydrolysis and absorption of long-chain triglyceride fatty acids in the intestine is located ~1 Mb upstream from the chromosome 10 peak(PMID:17890784). It is also named as PL, PTL and belongs to the AB hydrolase superfamily. It may potentially be involved in the pathophysiology of traumatic brain injury and may be implicated in the proliferation of astrocytes and the recovery of neurological outcomes(PMID:19760487). The full length protein has a signal peptide with 16 amino acid and a glycosylation site.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1681 Product name: Recombinant human PNLIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-465 aa of BC014309 Sequence: VNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGRRTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC Predict reactive species\nFull Name: pancreatic lipase\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 48-52 kDa\nGenBank Accession Number: BC014309\nGene Symbol: Pancreatic Lipase\nGene ID (NCBI): 5406\nRRID: AB_2167443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869006188713,"sku":"11209-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11209-1-ap","provider":"Iright","version":"1.0","type":"link"}