{"product_id":"proteintech-11221-1-ap","title":"Proteintech, 11221-1-AP, CXCL3\/GRO Gamma Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL3\/GRO Gamma (11221-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL3\/GRO Gamma in WB, ELISA applications with reactivity to human samples\n11221-1-AP targets CXCL3\/GRO Gamma in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LPS and Protein transport inhibitor treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1732 Product name: Recombinant human CXCL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC016308 Sequence: MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 3\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 8-10 kDa\nGenBank Accession Number: BC016308\nGene Symbol: CXCL3\nGene ID (NCBI): 2921\nRRID: AB_3669124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19876\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869528936617,"sku":"11221-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11221-1-ap","provider":"Iright","version":"1.0","type":"link"}