{"product_id":"proteintech-11232-2-ap","title":"Proteintech, 11232-2-AP, AEBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AEBP2 (11232-2-AP) by Proteintech is a Polyclonal antibody targeting AEBP2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n11232-2-AP targets AEBP2 in WB, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAEBP2, also named as Zinc finger protein AEBP2 or Adipocyte enhancer-binding protein 2, is a 517 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the AEBP2\/jing C2H2-type zinc-finger family. AEBP2 as a DNA-binding transcriptional repressor may interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. It may e playing a role in craniofacial and digital development, as well as development of the central nervous system and gastrointestinal tract.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1756 Product name: Recombinant human AEBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC015624 Sequence: MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR Predict reactive species\nFull Name: AE binding protein 2\nCalculated Molecular Weight: 33 kDa, 54 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC015624\nGene Symbol: AEBP2\nGene ID (NCBI): 121536\nRRID: AB_2225962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZN18\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991869097,"sku":"11232-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11232-2-ap","provider":"Iright","version":"1.0","type":"link"}