{"product_id":"proteintech-11237-1-ap","title":"Proteintech, 11237-1-AP, MIRO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIRO2 (11237-1-AP) by Proteintech is a Polyclonal antibody targeting MIRO2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11237-1-AP targets MIRO2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, human kidney tissue,  mouse heart tissue,  L02 cells,  HepG2 cells,  human testis tissue,  human heart tissue,  K-562 cells,  Hela cells\nPositive IP detected in: L02 cells\nPositive IHC detected in: human colon tissue, human kidney tissue,  human heart tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRHOT2 (Ras homolog gene family, member T2), also known as ARHT2, RASL or MIRO-2 (mitochondrial Rho GTPase 2), is a 618 amino acid single-pass type IV membrane protein as a member of the Rho family of GTPases. It is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. RHOT2 is ubiquitously expressed with highest levels found in pancreas, heart, kidney and skeletal muscle. MIRO2 is highly phosphorylated at basal conditions, as evidenced by an immunoreactive band that electrophoretically migrates 7 kDa higher (~75 kDa) compared to its predicted molecular weight (68 kDa) (PMID: 28556983).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1752 Product name: Recombinant human RHOT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-618 aa of BC014942 Sequence: DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ Predict reactive species\nFull Name: ras homolog gene family, member T2\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC014942\nGene Symbol: RHOT2\nGene ID (NCBI): 89941\nRRID: AB_2179539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXI1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864860329,"sku":"11237-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11237-1-ap","provider":"Iright","version":"1.0","type":"link"}