{"product_id":"proteintech-11254-1-ap","title":"Proteintech, 11254-1-AP, GLRX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLRX3 (11254-1-AP) by Proteintech is a Polyclonal antibody targeting GLRX3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11254-1-AP targets GLRX3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  MCF7 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human stomach cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLRX3(Glutaredoxin-3) is also named as PICOT, TXNL2. Mammalian glutaredoxin 3 is an essential protein involved in the regulation of signal transduction, for instance during immune cell activation and development of cardiac hypertrophy, presumably in response to redox signals(PMID:20226171). Glrx3 could take a pivotal role in colon and lung cancer cells during the tumorigenesis, which is expressed in lung and colon cancers consistently and preferentially(PMID:19797004).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1775 Product name: Recombinant human GLRX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC014372 Sequence: AQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLSSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN Predict reactive species\nFull Name: glutaredoxin 3\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC014372\nGene Symbol: GLRX3\nGene ID (NCBI): 10539\nRRID: AB_2110374\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76003\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980924585,"sku":"11254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11254-1-ap","provider":"Iright","version":"1.0","type":"link"}