{"product_id":"proteintech-11274-1-ap","title":"Proteintech, 11274-1-AP, ASAH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASAH1 (11274-1-AP) by Proteintech is a Polyclonal antibody targeting ASAH1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11274-1-AP targets ASAH1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, SH-SY5Y cells,  MCF-7 cells,  MDA-MB-231 cells,  SW480 cells,  T-47D cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). The predicted molecular weight of ASAH1 is 45 kDa. ASAH1 is a glycoprotein processed from a 55-60 kDa precursor via autoproteolytic cleavage into a mature heterodimeric enzyme formed by an α-subunit (13 kDa) and a β-subunit (37-40 kDa) (PMID: 22261821).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1799 Product name: Recombinant human ASAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-389 aa of BC016828 Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW Predict reactive species\nFull Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC016828\nGene Symbol: ASAH1\nGene ID (NCBI): 427\nRRID: AB_2058719\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13510\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915650729,"sku":"11274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11274-1-ap","provider":"Iright","version":"1.0","type":"link"}