{"product_id":"proteintech-11278-1-ap","title":"Proteintech, 11278-1-AP, TOM22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOM22 (11278-1-AP) by Proteintech is a Polyclonal antibody targeting TOM22 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11278-1-AP targets TOM22 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa, K-562 cells, HeLa cells,  mouse liver tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTom22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig   recognises  the  22 kDa  protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1797 Product name: Recombinant human TOMM22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC009363 Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Predict reactive species\nFull Name: translocase of outer mitochondrial membrane 22 homolog (yeast)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-22 kDa\nGenBank Accession Number: BC009363\nGene Symbol: TOMM22\/Tom22\nGene ID (NCBI): 56993\nRRID: AB_2207542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS69\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921745577,"sku":"11278-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11278-1-ap","provider":"Iright","version":"1.0","type":"link"}