{"product_id":"proteintech-11289-1-ap","title":"Proteintech, 11289-1-AP, PARP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PARP3 (11289-1-AP) by Proteintech is a Polyclonal antibody targeting PARP3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11289-1-AP targets PARP3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, human heart tissue,  human kidney tissue,  rat heart tissue,  mouse kidney tissue\nPositive IHC detected in: human breast cancer tissue, human pancreas cancer tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPARP3 (Poly(ADP-ribose) polymerase 3), also known as ARTD3, is the third member of the PARP family that catalyze a post-translational modification of proteins to promote, control or adjust numerous cellular events including genome integrity, transcription, differentiation, cell metabolism or cell death (PMID: 31095444). PARP3 is a 60-kDa protein containing an N-terminal WGR (tryptophan-, glycine-, and arginine-rich) domain and a C-terminal catalytic domain. PARP3 has been described to interact with partners belonging to the NHEJ pathway including DNA-PKcs, DNA ligase IV, Ku70 and Ku80 and to accelerate XRCC4\/DNA ligase IV-mediated ligation of chromosomal DSB in concert with APLF (PMID: 24598253).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1844 Product name: Recombinant human PARP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-533 aa of BC014260 Sequence: EALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL Predict reactive species\nFull Name: poly (ADP-ribose) polymerase family, member 3\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60-62 kDa\nGenBank Accession Number: BC014260\nGene Symbol: PARP3\nGene ID (NCBI): 10039\nRRID: AB_2283392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6F1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421326505,"sku":"11289-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11289-1-ap","provider":"Iright","version":"1.0","type":"link"}