{"product_id":"proteintech-11304-1-ap","title":"Proteintech, 11304-1-AP, Rab18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Rab18 (11304-1-AP) by Proteintech is a Polyclonal antibody targeting Rab18 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n11304-1-AP targets Rab18 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human heart tissue,  human brain tissue,  PC-3 cells,  human testis tissue,  mouse testis tissue,  rat brain tissue\nPositive IP detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: human stomach cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB18 is a member of a family of Ras-related small GTPases. RAB18 plays a role in apical endocytosis\/recycling, and may be implicated in transport between the plasma membrane and early endosomes. It also plays a key role in eye and brain development and neurodegeneration. Defects in RAB18 are associated with Warburg micro syndrome type 3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1841 Product name: Recombinant human RAB18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC015014 Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL Predict reactive species\nFull Name: RAB18, member RAS oncogene family\nCalculated Molecular Weight: 206 aa, 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC015014\nGene Symbol: RAB18\nGene ID (NCBI): 22931\nRRID: AB_2173932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP72\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868891566249,"sku":"11304-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11304-1-ap","provider":"Iright","version":"1.0","type":"link"}