{"product_id":"proteintech-11324-1-ap","title":"Proteintech, 11324-1-AP, DDX20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX20 (11324-1-AP) by Proteintech is a Polyclonal antibody targeting DDX20 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n11324-1-AP targets DDX20 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Jurkat cells,  mouse testis tissue,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells,  Hela cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEAD (Asp-Glu-Ala-Asp) box polypeptide 20 (DDX20), also known as DP103 or Gemin3, is a member of the DEAD box protein family expressed ubiquitously. DEAD family proteins use energy from ATP hydrolysis for RNA chaperoning and RNPase activity (PMID: 27121695). As a core member of the survival motor neuron (SMN) complex, DDX20 participate in small nuclear ribonucleoprotein (snRNP) biogenesis. Second, DDX20 have direct roles in gene expression in view of its implication in transcription and post-transcriptional gene silencing. Addition, the false expression of DDX20 could have deleterious effects on cellular homeostasis thus leading to cancer development and progression (PMID:29523774). Anymore, DDX20 could be identified as a biomarker and metastasis-driving oncogene of human breast cancer (PMID: 25083991). \nThe detected weight of DDX20 is slightly higher than the theoretical molecular weight that is because of  phosphorylation after translation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1863 Product name: Recombinant human DDX20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 520-824 aa of BC011556 Sequence: SHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVTEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 20\nCalculated Molecular Weight: 824 aa, 92 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC011556\nGene Symbol: DDX20\nGene ID (NCBI): 11218\nRRID: AB_2092401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933116073,"sku":"11324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11324-1-ap","provider":"Iright","version":"1.0","type":"link"}