{"product_id":"proteintech-11333-1-ap","title":"Proteintech, 11333-1-AP, TIFA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIFA (11333-1-AP) by Proteintech is a Polyclonal antibody targeting TIFA in WB, ELISA applications with reactivity to human samples\n11333-1-AP targets TIFA in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, L02 cells,  TT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIFA (TRAF-interacting protein with FHA domain-containing protein A ), also called T2BP, can interact with TRAF6 and plays an important role in innate immunity (PMID: 32910997; 35635239). Oligomerization of TIFA, which induces oligomerization and polyubiquitinylation of TRAF6, in turn activates TAK and IKK, finally mediates NF‐κB activation in the Toll‐like receptor 4\/interleukin‐1 signaling pathway (PMID: 15492226; 22566686). It has been reported that TIFA also plays various roles in different cancer types (PMID: 26501855; 29263897).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1876 Product name: Recombinant human TIFA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC014259 Sequence: MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES Predict reactive species\nFull Name: TRAF-interacting protein with forkhead-associated domain\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC014259\nGene Symbol: TIFA\nGene ID (NCBI): 92610\nRRID: AB_3669126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CG3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869777514665,"sku":"11333-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11333-1-ap","provider":"Iright","version":"1.0","type":"link"}