{"product_id":"proteintech-11335-1-ap","title":"Proteintech, 11335-1-AP, IRF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF1 (11335-1-AP) by Proteintech is a Polyclonal antibody targeting IRF1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n11335-1-AP targets IRF1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN gamma treated HeLa cells, HL-60 cells,  IFN gamma treated THP-1 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: IFN gamma treated HepG2 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, rabbit, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1879 Product name: Recombinant human IRF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC009483 Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP Predict reactive species\nFull Name: IRF 1\nCalculated Molecular Weight: 325 aa, 37 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC009483\nGene Symbol: IRF1\nGene ID (NCBI): 3659\nRRID: AB_2877759\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842250409,"sku":"11335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11335-1-ap","provider":"Iright","version":"1.0","type":"link"}