{"product_id":"proteintech-11366-1-ap","title":"Proteintech, 11366-1-AP, HINT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HINT3 (11366-1-AP) by Proteintech is a Polyclonal antibody targeting HINT3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11366-1-AP targets HINT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  human placenta tissue\nPositive IHC detected in: mouse liver tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman Hint3 (hHint3) has been classified as a member of the histidine triad nucleotide (Hint) binding protein subfamily. HIT superfamily consists primarily of nucleoside phosphoramidases, dinucleotide hydrolases, and nucleotidyl transferases. While Hint1 is ubiquitously expressed by both eukaryotes and prokaryotes, Hint3 is found only in eukaryotes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1912 Product name: Recombinant human HINT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC015732 Sequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT Predict reactive species\nFull Name: histidine triad nucleotide binding protein 3\nCalculated Molecular Weight: 182 aa, 20 kDa\nObserved Molecular Weight: 20-24 kDa\nGenBank Accession Number: BC015732\nGene Symbol: HINT3\nGene ID (NCBI): 135114\nRRID: AB_3669127\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQE9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667794089,"sku":"11366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11366-1-ap","provider":"Iright","version":"1.0","type":"link"}