{"product_id":"proteintech-11371-1-ap","title":"Proteintech, 11371-1-AP, HPS6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HPS6 (11371-1-AP) by Proteintech is a Polyclonal antibody targeting HPS6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11371-1-AP targets HPS6 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHermansky-Pudlak syndrome (HPS) defines a group of at least seven autosomal recessive disorders characterized by albinism and prolonged bleeding due to defects in the lysosome-related organelles, melanosomes and platelet-dense granules, respectively. HSP6, also named as Ru, regulates the synthesis and function of lysosomes and of highly specialized organelles, such as melanosomes and platelet dense granules. It acts as cargo adapter for the dynein-dynactin motor complex to mediate the transport of lysosomes from the cell periphery to the perinuclear region.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1929 Product name: Recombinant human HPS6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-775 aa of BC011594 Sequence: DDEEAGWTELAEQEVARLLRTELIGDQLAQLNTVFQALPTAAWGATLRALQLQLDGNGKLRSQAPPDVWKKVLGGITAGKEPPNGILPPFELLCQCLCQLEPRWLPPFVELAQQQGGPGWGAGGPGLPLYRRALAVLGEEGTRPEALELELLLSSGRPKAVLQAVGQLVQKEQWDRALDAGLALGPSSPLLRSEIFKLLLAEFAQHRRLDAHLPLLCRLCPPELAPAELLLLLRTYLPDEVGPPTPFPEPGAEPPLTVGLLKALLEQTGAQGWLSGPVLSPYEDILWDPSTPPPTPPRDL Predict reactive species\nFull Name: Hermansky-Pudlak syndrome 6\nCalculated Molecular Weight: 775 aa, 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC011594\nGene Symbol: HPS6\nGene ID (NCBI): 79803\nRRID: AB_2120693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869411692713,"sku":"11371-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11371-1-ap","provider":"Iright","version":"1.0","type":"link"}