{"product_id":"proteintech-11396-1-ap","title":"Proteintech, 11396-1-AP, RPH3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPH3A (11396-1-AP) by Proteintech is a Polyclonal antibody targeting RPH3A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11396-1-AP targets RPH3A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells,  human brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB3A is a small G protein that is thought to act in exocytosis of neurotransmitters and hormones in synaptic neurotransmission and cell-cell communication. RPH3A (RPH3A), a RAB3A effector, is a neuronal C2 domain tandem containing protein that is involved in the neuronal transmitter process. Huntington's disease (HD) is a hereditary neurodegenerative disorder characterized by progressive motor disturbances, cognitive defects and dementia. Level of rabphilin 3A is substantially decreased in synapses of most brain regions in R6\/1 transgenic mouse model of HD suggesting a role of RPH3A in impaired synaptic transmission.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1956 Product name: Recombinant human RPH3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC017259 Sequence: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGSRPGP Predict reactive species\nFull Name: rabphilin 3A homolog (mouse)\nCalculated Molecular Weight: 690 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC017259\nGene Symbol: RPH3A\nGene ID (NCBI): 22895\nRRID: AB_2181145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2J0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988100777,"sku":"11396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11396-1-ap","provider":"Iright","version":"1.0","type":"link"}