{"product_id":"proteintech-11400-1-ap","title":"Proteintech, 11400-1-AP, ASRGL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASRGL1 (11400-1-AP) by Proteintech is a Polyclonal antibody targeting ASRGL1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11400-1-AP targets ASRGL1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAsparaginase-like protein 1 (ASRGL1) is also named as ALP, CRASH and belongs to the Ntn-hydrolase family. ASRGL1 has both L-asparaginase and beta-aspartyl peptidase activity. It may be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. ASRGL1 has 2 isoforms produced by alternative splicing with the MW of 32 kDa and 19 kDa. Two lower molecular weight bands (23 and 15 kDa) can be detected corresponding to the processed α and β subunits (PMID: 27106100).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, cat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1955 Product name: Recombinant human ASRGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC021295 Sequence: MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP Predict reactive species\nFull Name: asparaginase like 1\nCalculated Molecular Weight: 308 aa, 32 kDa\nObserved Molecular Weight: 32-40 kDa, 20-25 kDa, 15-19 kDa\nGenBank Accession Number: BC021295\nGene Symbol: ASRGL1\nGene ID (NCBI): 80150\nRRID: AB_2060440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L266\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895957161,"sku":"11400-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-11400-1-ap","provider":"Iright","version":"1.0","type":"link"}